Get A Quote

PRODUCTS CENTER

Home > PRODUCTS CENTER >  fkm corrugated chemical hose 200psi

HYDRAULIC HOSE

INDUSTRIAL HOSE

PETROLEUM DRILLING HOSE

RUBBER COMPOUND AND RUBBER-PLASTIC SEALING PRODUCT

fkm corrugated chemical hose 200psi

Male NPT, Composite PTFE/FKM Diaphragm, w/ 0-200 PSI 2

Browse Item # MTG-22F200S-PVC, PVC Mini Tuff Guard Isolator, 1/4 Inlet Male NPT, Composite PTFE/FKM Diaphragm, w/ 0-200 PSI 2 Dia. Black

PROXITRON OFH-A1C3-4ZC-L_

AIRHOSE/H-7502 inner diameter 9.5MMEPDM17BAR FKM sealsLMGZ 205.200.25 S01.H29 200NType 30mA MAXVOLTAGE:30VDC MAXSUPPLY:100psi AMBIENT

811404802_811404802 811404802 -

enraf CT801 SI,Range:70/350mBar Turck FKM 10000psi 4-20mAMM300 FHC-D-W9 PDCF403EL/(0.4A\DC24V F67960)SM 15-200DDTLTA DC

Fast curing vulcanizable multi-part elastomer composition,

2008220-000 psi into a motionless mixer sealedly providedchemical cure rate retarders or through judicious FKM = fluorocarbon rubber comprisi

NORSOK M-710 Approved FKM Sealing Material

Fluoroelastomers (FKM) offer exceptional mechanicalchemical compatibility – leading to extremely long3 MPa / 3,090 psi 17.3 MPa / 2,510 psi

Shijiazhuang Orient Trade Co., Ltd.

Hydraulic Hose Assembly Added by Shijiazhuang 1. Material:PTFE,Q(SILICONE),FKM(FPM),TPU,CPU MM iN MM MPa Psi MPa Psi M 13 1/2 22 0

Resin Traps - SWT

• Clear PVC body with EPDM or FKM seals PP-E-THD 1 inch FPT EPDM 80 Mesh 200 psi Chemical Resistant Filters feature a chemically

Series Chemical Metering Pump, 192 GPD, 60 PSI, PVDF/FKM

Grundfosreg; DDA Series Chemical Metering Pump, 192 GPD, 60 PSI, PVDF/FKM Aeration Chart and Data Recorders Chemical Feed Collection Systems Elec

Nylon Braided Fuel Line Hose 500 PSI Fluoroelastomer FKM |

2016311--6 AN E85 Black Nylon Braided Fuel Line Hose 500 PSI Fluoroelastomer (FKM) in eBay Motors, Parts Accessories, Performance Racing Parts |

GN G 1/2 DN13 LF2 316L POM B - PDF

FKM, EPDM, MVQ Operating pressure: 350 Bar to200 Maintenance-free Flanged Ends Type Series PSI Technical Data for Test Hose A B C D

Multi-elastomer seal

across the seal 12 of 15,000 psi or greater.chemical attack, or the elastomer transitions from 90 Shore A Durometer FKM (e.g., a type of

BR Industrie-Elektronik ___

200 X 45 | HYDRAULIC NUT | - M 150 X 2 |2FKM5.4/S89(VW1233285) 8010471 5255/353909 BALL10000psi ball 12MP7-MPBLPKUH-V-SSP 313D2A

Gearbox, On Stands, 48907 Mixers-Blenders, Plow Chemical,

Littleford Fkm4200d For Sale Used Mixers-Blenders, Plow Federal Equipment Company Littleford #FKM4200D, Stainless SteelCHEMICAL, PETROLEUM, GAS PROCESSIN

Oil Fuel Hose,Fkm Fuel Hose,Fuel Hose Product on Alibaba.com

Hengtegu Manufacturer 5/16 Inch High Pessure Fkm Oil Fuel Hose , Find Complete Details about Hengtegu Manufacturer 5/16 Inch High Pessure Fkm Oil Fuel

Gauge With a vacuum pipe WRG-S-NW25|

2015112- CA10-G56M/4-HAN100.09kw; 3.2/3.8rpm200-024DC DN125 PN16 BODY:PP DISC:PVDF SEAL:FKM 600# RFF W/667 ACTUATOR 4-20mA 1 500psi

Hoentzsch Harmonic DriveHARMS+WENDE HARTING

2007516- 200 University Avenue West Waterloo, Ontario, Canada N2L 3G1 519 888 4883 All items in UWSpace are protected by copyright, with all rights

4WEH16D-7X/OF6EG24N9ES2K4__

201464-024DC DN125 PN16 BODY:PP DISC:PVDF SEAL:FKM RATTAY CORRUGATED HOSE I/S DN50 L=2870MM temp 92-343-1-005 0-300psi/0-2000kpa temp

ELOBAU 462124E1 barcontrolA-B-C-D-E-F

FKM4-2WAS3-0,3/0,3/XOR 8008098FLUID-TEAM 6X200Y00MHBM 1-U2A20TZGUWSTOBER FW0-2000-0280.5TO6Psi D51250*32D11381012NORGREN UM22152/

Fluoroelastomers for marking system components, including

chemical properties, as well as their release crosslinker may inhibit the grafting of FKM with3) (psi) P959-MgO/CaO 1445 (1404-1497) 404

Gauge, 2.5 Dia, FKM Diaphragm; 0 to 30 psi from Cole-Parmer

Buy Cole-Parmer Industrial Pressure/Process Gauge, 2.5 Dia, FKM Diaphragm; 0 to 30 psi and more from our comprehensive selection of Industrial Gauges

Fluoroelastomer compositions, their preparation, and their use

about 175 to 200° C. and a pressure of at least about 5,000 psi ( The procedure of Example 1 is followed in general except that the FKM

Functional consequences of sequence variation in the

DSDMKTLLEEVSIVFHLAAKLLFKMSLAAAV 70 ILNYLNSKAFAAIVRPSIILSSIREPIPGWLSGSHGFPRVVGAACKGLLLRWHGDG Amino acids are colored according to chemical

E35P1J0630XX01-160 FEVI_/____

SWITCH PRESSURE 175 PSI KRESS DE10P-20-210-WA200AL KPM 0236724/00-5 MQNH016-01C/W 16 cable/hose KELK BCCM415-0000-2B-R01 BALLUFF

LORENZ D2452 106101 0-0.2 N.m__

2015112-500bar - L=850mm, hose: Goldenblast/Plus DKOMANOMETER/RChG100-1-1-5BARG1/2FKM(041001/EPDM KRANZLE 3750PSI 180℃ KRAH-RWI ZDFA-P-SI 2

Shanghai Hongsheng Industry Co., Ltd.

FKM, The second represents the type of the raw175 kg/cm2 2600Psi 700kg/cm2 10000Psi 115 chemical processing, pharmaceutical industry,

pump for 200 litre drums PTFE/FKM 5.7 lpm 17 bar (250 psi)

View AccountCreate Account|LoginCondor Pumps freephone NZ 0508 044055 View Cart (0) $‎0.00 Toggle navigation Home Home Shopping cart My account

Solenoid Valve 21EN (FKM seal) - Valves by Type - Solenoid

Series 21EN solenoid valve models, with FKM Suction Discharge Hose Chemical Transfer Hose JGB Eagle Composite® 200 PSI Hose JGB Eagle

Pump, Gauge/Reg, PTFE/PPS/FKM; 0.19cfm/25.3Hg-35psi/115V:

: KNF Filtration Pump, Gauge/Reg, PTFE/PPS/FKM; 0.19cfm/25.3Hg-35psi/115V: Everything Else KNF Filtration Pump, Gauge/Reg, PTFE/PP

Thermoelectric polymer composite, method of making and use of

temperature greater than or equal to 200° F.FKM family and marketed under the tradename VITON(psi) to 2000 psi, and specifically 1200 psi

Solenoid Valve 21WN5-9 (FKM seal) - Valves by Type - Solenoid

2018716-Valves by Type - Solenoid Valve. JGB Enterprises, Inc. is a hose assembler of hydraulic and industrial hoses and hose assemblies for all app